1. Notes: 210 / 4 months ago  from metaconscious
    metaconscious:

13-Year-Old Makes Solar Power Breakthrough by Harnessing the Fibonacci Sequence
While most 13-year-olds spend their free time playing video games or cruising Facebook, one 7th grader was trekking through the woods uncovering a mystery of science. After studying how trees branch in a very specific way, Aidan Dwyer created a solar cell tree that produces 20-50% more power than a uniform array of photovoltaic panels. His impressive results show that using a specific formula for distributing solar cells can drastically improve energy generation. The study earned Aidan a provisional U.S patent – it’s a rare find in the field of technology and a fantastic example of how biomimicry can drastically improve design.
Aidan Dwyer took a hike through the trees last winter and took notice of patterns in the mangle of branches. His studies into how they branch in very specific ways lead him to a central guiding formula, the Fibonacci sequence. Take a number, add it to the number before it in a sequence like 1+1=2 then 2+1=3 then 3+2=5, 8, 13, 21 and so on a very specific pattern emerges. Turns out the pattern and its corresponding ratios are reflected in nature all the time, and Aidan’s keen observation of how trees branch according to the formula lead him to test the theory. First he measured tree branches by how often they branch and at what degree from each other.
To see why they branch this way he built a small solar array using the Fibonacci formula, stepping cells at specific intervals and heights. He then compared the energy output with identical cells set in a row. Aidan reports the results: “The Fibonacci tree design performed better than the flat-panel model. The tree design made 20% more electricity and collected 2 1/2 more hours of sunlight during the day. But the most interesting results were in December, when the Sun was at its lowest point in the sky. The tree design made 50% more electricity, and the collection time of sunlight was up to 50% longer!”
His results did turn out to be incorrect though. Voltage (what he measured) is not an accurate measure of energy from a solar cell– he measured higher voltage simply because he swept a larger portion of sky. Solar cells in series are as only as good as the weakest one, so the tree design is only as good as the worst positioned cell for amperage, which multiplied by voltage creates usable energy.
This story is very inspiring and I think that Aiden’s passion to unravel a mystery shows how exciting the path of scientific discovery is. Impressively he is demonstrating the power of biomimicry — a concept that many see as the pinnacle of good design, but one that thus far has been exceptionally difficult to achieve. Way to go!
+ The Secret of the Fibonacci Sequence in Trees
(via @heidiko44)

    metaconscious:

    13-Year-Old Makes Solar Power Breakthrough by Harnessing the Fibonacci Sequence

    While most 13-year-olds spend their free time playing video games or cruising Facebook, one 7th grader was trekking through the woods uncovering a mystery of science. After studying how trees branch in a very specific way, Aidan Dwyer created a solar cell tree that produces 20-50% more power than a uniform array of photovoltaic panels. His impressive results show that using a specific formula for distributing solar cells can drastically improve energy generation. The study earned Aidan a provisional U.S patent – it’s a rare find in the field of technology and a fantastic example of how biomimicry can drastically improve design.

    Aidan Dwyer took a hike through the trees last winter and took notice of patterns in the mangle of branches. His studies into how they branch in very specific ways lead him to a central guiding formula, the Fibonacci sequence. Take a number, add it to the number before it in a sequence like 1+1=2 then 2+1=3 then 3+2=5, 8, 13, 21 and so on a very specific pattern emerges. Turns out the pattern and its corresponding ratios are reflected in nature all the time, and Aidan’s keen observation of how trees branch according to the formula lead him to test the theory. First he measured tree branches by how often they branch and at what degree from each other.

    To see why they branch this way he built a small solar array using the Fibonacci formula, stepping cells at specific intervals and heights. He then compared the energy output with identical cells set in a row. Aidan reports the results: “The Fibonacci tree design performed better than the flat-panel model. The tree design made 20% more electricity and collected 2 1/2 more hours of sunlight during the day. But the most interesting results were in December, when the Sun was at its lowest point in the sky. The tree design made 50% more electricity, and the collection time of sunlight was up to 50% longer!”

    His results did turn out to be incorrect though. Voltage (what he measured) is not an accurate measure of energy from a solar cell– he measured higher voltage simply because he swept a larger portion of sky. Solar cells in series are as only as good as the weakest one, so the tree design is only as good as the worst positioned cell for amperage, which multiplied by voltage creates usable energy.

    This story is very inspiring and I think that Aiden’s passion to unravel a mystery shows how exciting the path of scientific discovery is. Impressively he is demonstrating the power of biomimicry — a concept that many see as the pinnacle of good design, but one that thus far has been exceptionally difficult to achieve. Way to go!

    + The Secret of the Fibonacci Sequence in Trees

    (via @heidiko44)

     
  2. Notes

    1. solarpowercentre reblogged this from future-physicist
    2. thepervygamedesigner reblogged this from athamemorrigan and added:
      13-Year-Old Makes Solar Power Breakthrough by Harnessing the Fibonacci Sequence...While...
    3. ambulat-in-bella reblogged this from psychedelicmandala
    4. onceuponadork3 reblogged this from threedaysofpeacepotandpussy
    5. acid-acid-acid reblogged this from threedaysofpeacepotandpussy
    6. threedaysofpeacepotandpussy reblogged this from wakeupandbefree
    7. greatestmyth reblogged this from starsinhereyes
    8. thejesterrace said: I love this.
    9. thejesterrace reblogged this from metaconscious
    10. iolani reblogged this from metaconscious
    11. sophielasoff reblogged this from psychedelicmandala
    12. rainbeauxs reblogged this from wakeupandbefree and added:
      My dad’s friend made an antenna for him on the cheap, with wiring based on the mandlebrot sequence. Needless to say, it...
    13. d00dbr0 reblogged this from wakeupandbefree
    14. wakeupandbefree reblogged this from livethelifeyourliving
    15. livethelifeyourliving reblogged this from psychedelicmandala
    16. mistressmomoko reblogged this from psychedelicmandala
    17. stfualicia reblogged this from psychedelicmandala
    18. bodhiduck reblogged this from psychedelicmandala
    19. psychedelicmandala reblogged this from metaconscious
    20. souslarbre reblogged this from theamericanbear
    21. lunaticprophet reblogged this from theamericanbear
    22. theamericanbear reblogged this from guerrillanetwork
    23. viewsfortheeconomy reblogged this from personalfantasia
    24. personalfantasia reblogged this from metaconscious
    25. enasmathematikos reblogged this from mightymaura and added:
      Every time I think φ isn’t particularly relevant to anything I read something like this
avatar_128
 
 
ੴ "Your position is irrelevant, it is the direction that you are heading that defines you." ॐ

Ask me a Question - Click Here!

Moments of a Journey

Snippets of Memories

Thoughts and Responses


Click images for sources ♥ & ☮
 
 

Following

allacharademysticmementosintrospectivestardustacidicfizzfuckyeahtattoosteenageodysseyweekndsareforl-o-v-eblissfuldreamsfuckyeahphotographicscrookedindifferencearadiosonggirlicanreadachefyeahqueervintagewecouldrunmissdisneylandlgbtlaughsfuckyeahfireflymilkteabellyelectrikcameolexluthrsomewhereinmytimekizerangelinothernewstheonlymagicleftisartfuckyeahwonderlandtopherchriszodiacchicdeadliestsnatchlogofezrathe-br0nxzenburdentumothyprojectqueerqueercandytreerootsmorganlillywordbonergenderqueerfuckyeahlesbiansfucktheorylollalovesemannersifeelfreeheartmindawakeningthisiskellygalwaysmoreiindiasex-death-rebirthnirvikalpagematriyaletitrainforeverfuckyeahhappypansexualpridereveillerlimaginationsmigingeminijunesmashinglemonzpurehempthedailywhatdearmeatonekarmafuckyeahtimburtoncircacaitlinquote-bookfuckyeahlgbtcoketalkforolivia-fuckyeahgirlskissingmafelagonza00sociologicstaffteamcocoheckyeahdanieljacksonshmamberlinjeannepiscesscorpioworldtarotwomanchiarachiariloveyourchaostheladyisagenttehhenbrokensounddazeerdxorescatatedeaddavefuckyeahaskabiilluminatedbeingrabbit--h0leelliethomasbassblasterfuckyeahbisexualsnymphetgardentumblrbotbanksystreetartpsychotherapyqueersecretsgatsandglitterdearcoquettemetaconsciousthedisneyvaultsaffuriceverythinglifeinhdoccupywallstreettranspridealackofwordsladyylazarusclandfetherstonequalitopiawackstersdreamingmissuniversestonerpartyannarveroldohhelloashleyonehelloworldtrippentiggergoodbyepandapianoimprobythegodsfuckyeahprotestihopeyourelisteningsemicolonlovecommondenserainballzsunshinejesusprayerfauxchenauxskycavethatonehelloworldguymayorofawesometownfyeahstrangefindsbritishpetroleumfuckyeahacesfeeshwhatyoushouldlistentoiwdrmnickykkrebeldoguniversewithinhollowayrobertscomicallyvintageasseenelsewherebeautifulbisexualshishawnfuckyeahradicalquotesfuckyeahphilosophyqueerozodiaccccceruleanstimulationambidextrosetumblrwaterfuckyeahrrrainbowsimthiskidfyeahwall-eph-chantornasunderdriftingupwardsthelvlsixaliwanvrbpresentsiamblesseddisneyfuckyeahmyholigaykimberlooloversandfightersm2migzfyeahcapricorndinosauregglgbtq-gmhfuckyeahsociologyxo-mariofuckyeahqueersmusicsexfamefuckyeahqueeryouthbisexualmequirky-qrstennymcnastyurmotherbilly-hongfuckyeahbeautifulgirlsnaturesecretsscorpiosmarky0markloveincessantlythongxxxywhytheyrehotweryrfrndsskinsyeahtomb-of-cleopatrickgirlfriendisahomograynbaynslgbtoutreachthisisgayagayadayfyp-calendardeltaofdavishyphynationthe0mitchlifebimeihearcoloursnomad-culturepeircyimmerse-yourself-in-lovequeereadstheycalleditlovebigyawpgpoyiranvit0riapyeemotoriousjuliabreaksallfortheloveofgooddesignsnackmasterallisonmariemiller
 

Tumblr